HORDB

ID: hor002051
Uniprot ID: P13562
Protein name: Prolactin release-inhibiting factor 1
Gene name: GNRH1
Organism: Mus musculus (Mouse)
Family: GnRH family
Source: animal
Expression: NA
Disease: NA
Comments: NA
Taxonomy: Mus (subgenus), Mus (genus), Murinae (subfamily), Muridae (family), Muroidea, Myomorpha (suborder), Rodentia (order), Glires, Euarchontoglires (superorder), Boreoeutheria, Eutheria, Theria, Mammalia (class), Amniota, Tetrapoda, Dipnotetrapodomorpha, Sarcopterygii (superclass), Euteleostomi, Teleostomi, Gnathostomata, Vertebrata, Craniata (subphylum), Chordata (phylum), Deuterostomia, Bilateria, Eumetazoa, Metazoa (kingdom), Opisthokonta, Eukaryota (superkingdom), cellular organisms
GO MF: GO:0005179 hormone activity; GO:0005183 gonadotropin hormone-releasing hormone activity; GO:0031530 gonadotropin-releasing hormone receptor binding
GO BP: GO:0000003 reproduction; GO:0007165 signal transduction; GO:0010468 regulation of gene expression; GO:0030238 male sex determination; GO:0033087 negative regulation of immature T cell proliferation; GO:0043066 negative regulation of apoptotic process; GO:0045471 response to ethanol; GO:0048545 response to steroid hormone; GO:2000354 regulation of ovarian follicle development; GO:2001223 negative regulation of neuron migration
GO CC: GO:0005576 extracellular region; GO:0005615 extracellular space

Sequence: NTEHLVESFQEMGKEVDQMAEPQHFECTVHWPRSPLRDLRGALESLIEEEARQKKM
Length: 56
Propeptide: MILKLMAGILLLTVCLEGCSSQHWSYGLRPGGKRNTEHLVESFQEMGKEVDQMAEPQHFECTVHWPRSPLRDLRGALESLIEEEARQKKM
Signal peptide: MILKLMAGILLLTVCLEGCSS
Modification: NA
Glycosylation: NA
Mutagenesis: NA

Function: Stimulates the secretion of gonadotropins; it stimulates the secretion of both luteinizing and follicle-stimulating hormones.
Mechanism: NA
Cross BBB: NA
Target: Gnrhr
Target Unid: Q01776
IC50: NA
EC50: NA
ED50: NA
kd: NA
Half life: NA

Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)

hor002051_AF2.pdb

hor002051_ESM.pdb

Mass:	760364	Formula:	C285H449N83O91S4
Absent amino acids:	Y	Common amino acids:	E
pI:	4.77	Basic residues:	10
Polar residues:	9	Hydrophobic residues:	15
Hydrophobicity:	-96.07	Boman Index:	-15442
Half-Life:	1.4 hour	Half-Life Yeast:	3 min
Half-Life E.Coli:	>10 hour	Aliphatic Index	62.68
Instability Index:	8384.29	Extinction Coefficient cystines:	5500
Absorbance 280nm:	100